PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_20268_BGI-A2_v1.0
Common NameF383_03767, F383_15217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 555aa    MW: 61372.4 Da    PI: 5.0411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_20268_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-173986148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Cotton_A_20268_BGI-A2_v1.0 39 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                                79******************************************9986 PP

2Myb_DNA-binding48.22.4e-1592135146
                                 TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
             Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                 +g++T eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
  Cotton_A_20268_BGI-A2_v1.0  92 KGAFTREEEHLIIELHAKMGNK-WARMAANLP-GRTDNEIKNYWNT 135
                                 799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2783486IPR017930Myb domain
SuperFamilySSF466892.58E-2938133IPR009057Homeodomain-like
SMARTSM007172.4E-153888IPR001005SANT/Myb domain
PfamPF002492.4E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-234093IPR009057Homeodomain-like
CDDcd001671.06E-114186No hitNo description
PROSITE profilePS5129425.50887141IPR017930Myb domain
SMARTSM007178.7E-1591139IPR001005SANT/Myb domain
PfamPF002491.8E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2494140IPR009057Homeodomain-like
CDDcd001672.10E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MSHTKNERED GMLSKNRKEL PLIDDGNYGD ADGGALLKKG PWTSAEDAIL IDYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTREEE HLIIELHAKM GNKWARMAAN  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCVQALKES HRTSAISGGD KGTHDILQNN  180
TYEIPDVIFD SLKANQNVLP YVPELPDISA SCMMMKVLGS SQYSSFIPPA IHRQKRLRES  240
AAFSPGYTAA VKNDCPLFEQ FEDNMFDKAA QPFGQSFPFE PDPLTKKSQS FSAFQGSHAL  300
SHGNFSASEP TLEAVKLELP SLQYPETELE NWGTLSCSSS LLESIDAFIQ SPQTTSGVVL  360
DSLSPRNSGL LDALLHEAKT LSSAKNHASD KSSNSSTPCD IAERSNFNTC ETEWENYGET  420
LSPMCHSATS FFSESISASG SSLDEQPPAE TFTEPHTKSE SSDHVLAPEV EKEAPIWSDG  480
RCPDTLFASN WLEQGSGYDK DQTIMIDAIA TLLGDDLSSE YRSMLAGTSV SSQAWEPSWC  540
AWNNMPAVCQ MTELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31371405107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591468e-42AJ459146.1 Gossypium hirsutum partial myb118 gene, clone pGhMYB118.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459894.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_012459895.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_012459897.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A0B0N8680.0A0A0B0N868_G
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-130myb domain protein 33